- Application Platform (AP)
- Basis Components (BC)
- Business Mobile (MOB)
- Business Network Solutions (BNS)
- Controlling (CO)
- Cross-Application Components (CA)
- Cross-Application Components (CA)
- Customer Relationship Management (CRM)
- Enterprise Contract Management (CM)
- Enterprise Controlling (EC)
- Enterprise information management solutions (EIM)
- Environment, Health, and Safety / Product Compliance (EHS)
- Product Safety (EHS-SAF)
- SAP EHS Management (EHS-MGM)
- Sustainability (EHS-SUS)
- Dangerous Goods (EHS-SUS-DG)
- Environment Management (EHS-SUS-EM)
- Health & Safety Management (EHS-SUS-HS)
- Incident Management (EHS-SUS-IM)
- Product Marketability (EHS-SUS-PMA)
- Safety Data Sheets (EHS-SUS-SDS)
- Sustainability Content Infrastructure (EHS-SUS-CI)
- Sustainability Foundation (EHS-SUS-FND)
- Waste Management (EHS-SUS-WA)
- Financial Accounting (FI)
- Financial Services (FS)
- Global Trade Services (SLL)
- Investment Management (IM)
- LOD Components (LOD)
- Legal Content Management (LCM)
- Logistics - General (LO)
- Logistics Execution (LE)
- Materials Management (MM)
- Occasional Platform User (OPU)
- Payroll (PY)
- Personnel Management (PA)
- Plant Maintenance (PM)
- Portfolio and Project Management (PPM)
- Product Lifecycle Management (PLM)
- Production Planning and Control (PP)
- Project System (PS)
- Public Sector Management (PSM)
- Purchasing SAP Cloud (PUR)
- Quality Management (QM)
- Real Estate Management (RE)
- SAP Business Warehouse (BW)
- SAP Supplier Lifecycle Management (SLC)
- Sales and Distribution (SD)
- Service (SV)
- Supply Chain Management (SCM)
- Sustainability management (SUS)
- Transportation Management (TM)
C_IncidentTaskDefTypeVH
Incident Task Definition Value Help
| view: CEHSINCTDTVH
| Extraction:
Not supported
| Component: Incident Management
Tables used:
EHFNDC_CLASSDEF, EHFNDC_TASKDEF
- 🔑 Keys (1)
- 💰 Amounts
- ∑ Quantities
- 📅 Dates
- ☰ Categorical
- Other
- 🔗 Relations (1)
| Column Name | Description | |
|---|---|---|
| EHSTaskDefinitionType FK | Task Type |
| Column Name | Description |
|---|
| Column Name | Description |
|---|
| Column Name | Description |
|---|
| Column Name | Description |
|---|
| Column Name | Description | Domain name |
|---|
| Master Data Relations | Join Conditions |
|---|---|
| Task Type | C_INCIDENTTASKDEFTYPEVH.EHSTASKDEFINITIONTYPE == EHFNDC_EVENTDEF.EVENT |