P_MaterialStockTimeSeries

Determine material stock for the periods of period type | view: PMATSTOCKTIMESER | TRAN | Extraction: Not supported | Component: VDM Stock and Goods Movements
Column Name Description
PeriodType null
StartDate Start Date of Fiscal Period
EndDate End Date of Fiscal Period
YearPeriod Fiscal Year + Fiscal Period
Material Material in Respect of Which Stock is Managed
Plant Plant
StorageLocation Storage location
Batch Batch Number (Stock Identifier)
Supplier Supplier for Special Stock
SDDocument Sales order number of valuated sales order stock
SDDocumentItem Sales Order Item of Valuated Sales Order Stock
WBSElementInternalID Valuated Sales Order Stock WBS Element
Customer Customer for Special Stock
InventoryStockType Stock Type of Goods Movement (Stock Identifier) Show values
InventorySpecialStockType Special Stock Type
MaterialBaseUnit Base Unit of Measure
CompanyCode Company Code
FiscalYearVariant FK Fiscal Year Variant
Currency Company Code Currency
CostEstimate Cost Estimate Number - Product Costing
Column Name Description
Column Name Description
📏 Base Unit of Measure (MaterialBaseUnit):
MatlWrhsStkQtyInMatlBaseUnit Stock Quantity
MatlCnsmpnQtyInMatlBaseUnit Stock Quantity
Column Name Description
StartDate Start Date of Fiscal Period
EndDate End Date of Fiscal Period
Column Name Description
InventoryStockType Stock Type of Goods Movement (Stock Identifier) Show values
Column Name Description Domain name
MatlStkQtySumInPeriod null
Master Data Relations Join Conditions
Fiscal Year Variant
  • Client
  • Fiscal Year Variant
  • P_MATERIALSTOCKTIMESERIES.MANDT == T009.MANDT
  • P_MATERIALSTOCKTIMESERIES.FISCALYEARVARIANT == T009.PERIV