- Application Platform (AP)
- Basis Components (BC)
- Business Mobile (MOB)
- Business Network Solutions (BNS)
- Controlling (CO)
- Cross-Application Components (CA)
- Cross-Application Components (CA)
- Customer Relationship Management (CRM)
- Enterprise Contract Management (CM)
- Enterprise Controlling (EC)
- Enterprise information management solutions (EIM)
- Environment, Health, and Safety / Product Compliance (EHS)
- Financial Accounting (FI)
- Accounts Payable (FI-AP)
- Accounts Receivable (FI-AR)
- Additional Functions (FI-AF)
- Asset Accounting (FI-AA)
- Bank Accounting (FI-BL)
- Central Finance (FI-CF)
- Consolidation (FI-LC)
- Contract Accounts Receivable and Payable (FI-CA)
- Convergent Contract Accounting (FI-CAC)
- Financial Supply Chain Management (FIN-FSCM)
- Collections Management (FIN-FSCM-COL)
- Credit Management (FIN-FSCM-CR)
- Digital Payments (FIN-FSCM-DP)
- Direct Bank Communication (FIN-FSCM-BNK)
- Dispute Management (FIN-FSCM-DM)
- Financial Risk Management for Commodities (FIN-FSCM-CMM)
- One Exposure (FIN-FSCM-FQM)
- Payment Factory (FIN-FSCM-PF)
- SAP Cash Management (FIN-FSCM-CLM)
- Treasury and Risk Management (FIN-FSCM-TRM)
- Fiori UI for Financial Accounting (FI-FIO)
- Fiori UI for Financials (FIN-FIO)
- Funds Management (FI-FM)
- General Ledger Accounting (FI-GL)
- Localization (FI-LOC)
- Predictive Accounting (FI-PRA)
- Real-Time Consolidation (FIN-RTC)
- Revenue Accounting (FI-RA)
- S4HANA Financial Consolidation[Cloud] (FIN-CS)
- SAP Simple Finance data migration (FIN-MIG)
- Special Purpose Ledger (FI-SL)
- Tax Subledger (FI-TXL)
- Financial Services (FS)
- Global Trade Services (SLL)
- Investment Management (IM)
- LOD Components (LOD)
- Legal Content Management (LCM)
- Logistics - General (LO)
- Logistics Execution (LE)
- Materials Management (MM)
- Occasional Platform User (OPU)
- Payroll (PY)
- Personnel Management (PA)
- Plant Maintenance (PM)
- Portfolio and Project Management (PPM)
- Product Lifecycle Management (PLM)
- Production Planning and Control (PP)
- Project System (PS)
- Public Sector Management (PSM)
- Purchasing SAP Cloud (PUR)
- Quality Management (QM)
- Real Estate Management (RE)
- SAP Business Warehouse (BW)
- SAP Supplier Lifecycle Management (SLC)
- Sales and Distribution (SD)
- Service (SV)
- Supply Chain Management (SCM)
- Sustainability management (SUS)
- Transportation Management (TM)
I_TrsyValAtRskDeltaGammaCharcs
Treasury VaR Delta Gamma with Analysis Characteristics
| view: ITRVARDGCHAR | TRAN
| Extraction:
Not supported
| Component: Market Risk Analyzer
Tables used:
FTB_I73_STATIC, JBDOBJ1, AFWGO_SETRUNPARA, RDBRA_RF_VALUE, RDBRA_REC_HEADER, RDBRA_REC_TBP
- 🔑 Keys (4)
- 💰 Amounts
- ∑ Quantities
- 📅 Dates (3)
- ☰ Categorical (1)
- Other (13)
- 🔗 Relations (6)
| Column Name | Description | |
|---|---|---|
| ValidityDate | Key Date in Results Databases | |
| TreasuryFinancialObject | Object Number of External Reference | |
| MarketRiskHierarchyNode | Node of Risk Hierarchy | |
| MarketRiskKeyFigureSet | Market Risk Key Figure Set |
| Column Name | Description |
|---|
| Column Name | Description |
|---|
| Column Name | Description | |
|---|---|---|
| ValidityDate | Key Date in Results Databases | |
| TrsyFinObjValidityStartDate | Transaction Start for Risk Management | |
| TrsyFinObjValidityEndDate | Transaction End for Risk Management |
| Column Name | Description | |
|---|---|---|
| TreasuryContractType | Contract Type | Show values |
| Column Name | Description | Domain name | |
|---|---|---|---|
| NPVRiskFactorDeltaValue | Key Figure Value in Results Databases | ||
| NPVRiskFactorWgtdDeltaValue | null | ||
| NPVRiskFactorGammaValue | Key Figure Value in Results Databases | ||
| NPVRiskFactorWgtdGammaValue | null | ||
| FinancialInstrumentProductType | Product Type | VVSART | |
| Portfolio | Portfolio | RPORTB | |
| FinancialTransaction | Financial Transaction | T_RFHA | |
| SecurityClass | Security Class ID Number | WP_RANL | |
| SecurityAccount | Securities Account | RLDEPO | |
| TreasuryPositionAccount | Futures Account for Listed Options and Futures | TPM_POS_ACCOUNT_FUT | |
| FinancialExposurePosition | Exposure Position ID | FTR_POSITION_ID | |
| LoanContract | Contract Number | RANL | |
| FinancialInstrCharacteristic | Characteristics | CHAR25 |
| Master Data Relations | Join Conditions |
|---|---|
Business Partner Number
| |
Company Code
| |
Country/Region Key
| |
Evaluation Currency
| |
| Product Category | I_TRSYVALATRSKDELTAGAMMACHARCS.FINANCIALINSTRPRODUCTCATEGORY == TZAF.SANLF |
Analytic Characteristic Currency
|