I_MaterialStockTimeSeries

Material Stock For Periods | view: IMATSTOCKTIMESER | TRAN | Extraction: Not supported | Component: VDM Stock and Goods Movements
Column Name Description
PeriodType null
EndDate End Date of Fiscal Period
YearPeriod Fiscal Year + Fiscal Period
Material Material in Respect of Which Stock is Managed
Plant Plant
StorageLocation Storage location
Batch Batch Number (Stock Identifier)
Supplier Supplier for Special Stock
SDDocument Sales order number of valuated sales order stock
SDDocumentItem Sales Order Item of Valuated Sales Order Stock
WBSElementInternalID Valuated Sales Order Stock WBS Element
Customer Customer for Special Stock
InventoryStockType Stock Type of Goods Movement (Stock Identifier) Show values
InventorySpecialStockType Special Stock Type
FiscalYearVariant FK Fiscal Year Variant
MaterialBaseUnit Base Unit of Measure
Column Name Description
Column Name Description
📏 Base Unit of Measure (MaterialBaseUnit):
MatlWrhsStkQtyInMatlBaseUnit Stock Quantity
Column Name Description
EndDate End Date of Fiscal Period
Column Name Description
InventoryStockType Stock Type of Goods Movement (Stock Identifier) Show values
Column Name Description Domain name
CostEstimate Cost Estimate Number - Product Costing CK_KALNR
CompanyCode Company Code BUKRS
Master Data Relations Join Conditions
Fiscal Year Variant
  • Fiscal Year Variant
  • Client
  • I_MATERIALSTOCKTIMESERIES.FISCALYEARVARIANT == T009.PERIV
  • I_MATERIALSTOCKTIMESERIES.MANDT == T009.MANDT