I_FiscalYearWeek

Fiscal Year Week with Next Fiscal Year Week | view: IFIFYEARWEEK | ATTR | Extraction: Not supported | Component: Cross-Application Services Fiscal Calendar
Tables used: FINSC_FISC_DATE
Column Name Description
FiscalYearVariant FK Fiscal Year Variant
FiscalYear Fiscal Year
FiscalYearWeek Fiscal Year + Fiscal Week
Column Name Description
Column Name Description
Column Name Description
FiscalYearStartDate Start Date of Fiscal Year
FiscalYearEndDate End Date of Fiscal Year
FiscalWeekStartDate Start Date of Fiscal Week
FiscalWeekEndDate End Date of Fiscal Week
NextFiscalWeekStartDate null
NextFiscalWeekEndDate null
Column Name Description
Column Name Description Domain name
FiscalWeek Fiscal Week FINS_FISCALWEEK
FiscalWeekConsecutiveNumber Fiscal Year Week (Numbering) FINS_FYEARWEEK_I
NextFiscalYearWeek null
NextFiscalWeek null
NextFsclWeekConsecutiveNmbr null
Master Data Relations Join Conditions
Fiscal Year Variant
  • Client
  • Fiscal Year Variant
  • I_FISCALYEARWEEK.MANDT == T009.MANDT
  • I_FISCALYEARWEEK.FISCALYEARVARIANT == T009.PERIV