- Application Platform (AP)
- Basis Components (BC)
- Business Mobile (MOB)
- Business Network Solutions (BNS)
- Controlling (CO)
- Cross-Application Components (CA)
- Cross-Application Components (CA)
- Customer Relationship Management (CRM)
- SAP S/4HANA Service (CRM-S4)
- S4CRM: Analytics (CRM-S4-ANA)
- S4CRM: Basic Functions (CRM-S4-BF)
- S4CRM: Business Transaction Framework (CRM-S4-BTX)
- S4CRM: Case Management (CRM-S4-CM)
- S4CRM: Complaints (CRM-S4-COM)
- S4CRM: In-House Repair (CRM-S4-IHR)
- S4CRM: Master Data (CRM-S4-MD)
- S4CRM: Pre-Sales & Sales (CRM-S4-SLS)
- S4CRM: Public Services Industry (CRM-S4-IPS)
- S4CRM: Reporting (CRM-S4-REP)
- S4CRM: Service Management (CRM-S4-SRV)
- S4CRM: Solution (CRM-S4-SOL)
- S4CRM: Subscription Order Management (CRM-S4-SOM)
- S4CRM: Utilities Industry (CRM-S4-IU)
- SAP S/4HANA Service (CRM-S4)
- Enterprise Contract Management (CM)
- Enterprise Controlling (EC)
- Enterprise information management solutions (EIM)
- Environment, Health, and Safety / Product Compliance (EHS)
- Financial Accounting (FI)
- Financial Services (FS)
- Global Trade Services (SLL)
- Investment Management (IM)
- LOD Components (LOD)
- Legal Content Management (LCM)
- Logistics - General (LO)
- Logistics Execution (LE)
- Materials Management (MM)
- Occasional Platform User (OPU)
- Payroll (PY)
- Personnel Management (PA)
- Plant Maintenance (PM)
- Portfolio and Project Management (PPM)
- Product Lifecycle Management (PLM)
- Production Planning and Control (PP)
- Project System (PS)
- Public Sector Management (PSM)
- Purchasing SAP Cloud (PUR)
- Quality Management (QM)
- Real Estate Management (RE)
- SAP Business Warehouse (BW)
- SAP Supplier Lifecycle Management (SLC)
- Sales and Distribution (SD)
- Service (SV)
- Supply Chain Management (SCM)
- Sustainability management (SUS)
- Transportation Management (TM)
I_CustMgmtSrvcTeamPrflTeamType
Team Type for Service Team Profile
| view: ICMTMPRFLTMTYPE
| Extraction:
Not supported
| Component: S4CRM: Business Transaction Framework
Tables used:
CRMS4C_TEAM_PFTY
- 🔑 Keys (2)
- 💰 Amounts
- ∑ Quantities
- 📅 Dates
- ☰ Categorical
- Other
- 🔗 Relations (2)
| Column Name | Description | |
|---|---|---|
| CustMgmtServiceTeamProfile FK | Service Team Profile | |
| RespyMgmtTeamType FK | Team Type |
| Column Name | Description |
|---|
| Column Name | Description |
|---|
| Column Name | Description |
|---|
| Column Name | Description |
|---|
| Column Name | Description | Domain name |
|---|
| Master Data Relations | Join Conditions |
|---|---|
Team Profile
|
|
| Team Type | I_CUSTMGMTSRVCTEAMPRFLTEAMTYPE.MANDT == RSM_TEAM_TYP_C.MANDT |