- Application Platform (AP)
- Basis Components (BC)
- Business Mobile (MOB)
- Business Network Solutions (BNS)
- Controlling (CO)
- Cross-Application Components (CA)
- Asset Retirement Obligation Management for Oil & Gas (CA-ARO)
- Available to Promise (ATP) (CA-ATP)
- Bank (CA-BK)
- CA-VCM: Value Chain Management (CA-VCM)
- Classification (CA-CL)
- Commercial Project Management (CA-CPD)
- Cross functional developments in Asset Intell. N/W (CA-AIN)
- Cross-Application Objects in HR (CA-HR)
- Data Transformation (CA-DT)
- Document Management System (CA-DMS)
- Field Logistics (CA-FL)
- General Application Functions (CA-GTF)
- Business Document Flow (CA-GTF-BPF)
- Business Event Handling (CA-GTF-BEH)
- Business Event Logging (CA-GTF-BEL)
- Business User Management (CA-GTF-BUM)
- Commodity Pricing Engine (CA-GTF-CPE)
- Consent Administration (CA-GTF-CON)
- Contextual Business Navigation (CA-GTF-CBN)
- Country/Region-Specific Application Interface Objects (CA-GTF-CSC)
- Cross-Application Services General Ledger (CA-GTF-GL)
- DART (Data Retention Tool) (CA-GTF-DRT)
- Date Function (CA-GTF-DF)
- Digital Access (CA-GTF-DA)
- Feature Management (CA-GTF-FM)
- Financial Closing cockpit Add-on (CA-GTF-FCC)
- Fiori Xperience Unit (FXU) (CA-GTF-FXU)
- HANA Search for Business Suite (CA-GTF-HSB)
- Responsibility Management (CA-GTF-RM)
- S/4HANA Extensibility and Integration (CA-GTF-EI)
- SAP S/4HANA Data Migration Cockpit Content (LTMC) (CA-GTF-MIG)
- SAP Smart Business for S/4HANA (CA-GTF-ANA)
- Virtual Data Model (CA-GTF-VDM)
- s-Innovations Output Management (CA-GTF-OC)
- Integration from S/4HC to Master Data for Worker (CA-WFD)
- Issue & Activity Management (CA-IAM)
- Joint Venture und Production Sharing Accounting (CA-JVA)
- Landscape Transformation (CA-LT)
- Machine Learning (CA-ML)
- Master Data Governance. (CA-MDG)
- Master Data Integration Services (CA-MDI)
- PLM Audit Management (CA-AUD)
- Prepayment agreements (CA-PPA)
- Processes and Tools for Enterprise Applications (CA-EPT)
- Production Volume Capture (CA-PVL)
- Resource Scheduling (CA-RSH)
- SAP UI development toolkit for HTML5 - Rendering library (CA-UI5)
- Situation handling across applications, generic (CA-SIT)
- Time Sheet (CA-TS)
- Cross-Application Components (CA)
- Asset Retirement Obligation Management for Oil & Gas (CA-ARO)
- Available to Promise (ATP) (CA-ATP)
- Bank (CA-BK)
- CA-VCM: Value Chain Management (CA-VCM)
- Classification (CA-CL)
- Commercial Project Management (CA-CPD)
- Cross functional developments in Asset Intell. N/W (CA-AIN)
- Cross-Application Objects in HR (CA-HR)
- Data Transformation (CA-DT)
- Document Management System (CA-DMS)
- Field Logistics (CA-FL)
- General Application Functions (CA-GTF)
- Business Document Flow (CA-GTF-BPF)
- Business Event Handling (CA-GTF-BEH)
- Business Event Logging (CA-GTF-BEL)
- Business User Management (CA-GTF-BUM)
- Commodity Pricing Engine (CA-GTF-CPE)
- Consent Administration (CA-GTF-CON)
- Contextual Business Navigation (CA-GTF-CBN)
- Country/Region-Specific Application Interface Objects (CA-GTF-CSC)
- Cross-Application Services General Ledger (CA-GTF-GL)
- DART (Data Retention Tool) (CA-GTF-DRT)
- Date Function (CA-GTF-DF)
- Digital Access (CA-GTF-DA)
- Feature Management (CA-GTF-FM)
- Financial Closing cockpit Add-on (CA-GTF-FCC)
- Fiori Xperience Unit (FXU) (CA-GTF-FXU)
- HANA Search for Business Suite (CA-GTF-HSB)
- Responsibility Management (CA-GTF-RM)
- S/4HANA Extensibility and Integration (CA-GTF-EI)
- SAP S/4HANA Data Migration Cockpit Content (LTMC) (CA-GTF-MIG)
- SAP Smart Business for S/4HANA (CA-GTF-ANA)
- Virtual Data Model (CA-GTF-VDM)
- s-Innovations Output Management (CA-GTF-OC)
- Integration from S/4HC to Master Data for Worker (CA-WFD)
- Issue & Activity Management (CA-IAM)
- Joint Venture und Production Sharing Accounting (CA-JVA)
- Landscape Transformation (CA-LT)
- Machine Learning (CA-ML)
- Master Data Governance. (CA-MDG)
- Master Data Integration Services (CA-MDI)
- PLM Audit Management (CA-AUD)
- Prepayment agreements (CA-PPA)
- Processes and Tools for Enterprise Applications (CA-EPT)
- Production Volume Capture (CA-PVL)
- Resource Scheduling (CA-RSH)
- SAP UI development toolkit for HTML5 - Rendering library (CA-UI5)
- Situation handling across applications, generic (CA-SIT)
- Time Sheet (CA-TS)
- Customer Relationship Management (CRM)
- Enterprise Contract Management (CM)
- Enterprise Controlling (EC)
- Enterprise information management solutions (EIM)
- Environment, Health, and Safety / Product Compliance (EHS)
- Financial Accounting (FI)
- Financial Services (FS)
- Global Trade Services (SLL)
- Investment Management (IM)
- LOD Components (LOD)
- Legal Content Management (LCM)
- Logistics - General (LO)
- Logistics Execution (LE)
- Materials Management (MM)
- Occasional Platform User (OPU)
- Payroll (PY)
- Personnel Management (PA)
- Plant Maintenance (PM)
- Portfolio and Project Management (PPM)
- Product Lifecycle Management (PLM)
- Production Planning and Control (PP)
- Project System (PS)
- Public Sector Management (PSM)
- Purchasing SAP Cloud (PUR)
- Quality Management (QM)
- Real Estate Management (RE)
- SAP Business Warehouse (BW)
- SAP Supplier Lifecycle Management (SLC)
- Sales and Distribution (SD)
- Service (SV)
- Supply Chain Management (SCM)
- Sustainability management (SUS)
- Transportation Management (TM)
C_PaytFrmtTreeLevel
Payment Format Tree Level
| view: CPAYFRTRLVL
| Extraction:
Not supported
| Component: Data Medium Exchange Engine
Tables used:
DMEE_TREE_LEVEL
- 🔑 Keys (4)
- 💰 Amounts
- ∑ Quantities
- 📅 Dates
- ☰ Categorical
- Other (1)
- 🔗 Relations (3)
| Column Name | Description | |
|---|---|---|
| HierarchyTreeType FK | Mapping Type ID | |
| HierarchyTree FK | Format Mapping Name | |
| HierarchyTreeVersion FK | Tree Version | |
| HierarchyNodeLevel | Node Level |
| Column Name | Description |
|---|
| Column Name | Description |
|---|
| Column Name | Description |
|---|
| Column Name | Description |
|---|
| Column Name | Description | Domain name | |
|---|---|---|---|
| LevelRepetitionLimitValue | Repetition limit for a level | DMEE_REP_LIMIT |
| Master Data Relations | to Other Relations ↓ | Join Conditions |
|---|---|
| Mapping Type ID | C_PAYTFRMTTREELEVEL.HIERARCHYTREETYPE == DMEE_TREE_TYPE.TREE_TYPE |
| Other Relations | Join Conditions |
|---|---|
Format Mapping Name
|
|
Tree Version
|
|