C_MaterialStockTimeSeries

Material stock for periods by type | view: CMATSTOCKTIMESER | TRAN | Extraction: Not supported | Component: VDM Stock and Goods Movements
Column Name Description
Column Name Description
Column Name Description
📏 Base Unit of Measure (MaterialBaseUnit):
MatlWrhsStkQtyInMatlBaseUnit Stock Quantity
Column Name Description
EndDate End Date of Fiscal Period
Column Name Description
InventoryStockType Stock Type of Goods Movement (Stock Identifier) Show values
Column Name Description Domain name
PeriodType null
YearPeriod Fiscal Year + Fiscal Period FINS_FYEARPERIOD
Material Material in Respect of Which Stock is Managed MATNR
Plant Plant WERKS
StorageLocation Storage location LGORT
Batch Batch Number (Stock Identifier) CHARG
Supplier Supplier for Special Stock LIFNR
SDDocument Sales order number of valuated sales order stock VBELN
SDDocumentItem Sales Order Item of Valuated Sales Order Stock NUM06
WBSElementInternalID Valuated Sales Order Stock WBS Element PS_POSNR
Customer Customer for Special Stock KUNNR
InventorySpecialStockType Special Stock Type SOBKZ
CompanyCode Company Code BUKRS
MaterialName Material Description TEXT40
CompanyCodeName Name of Company Code or Company TEXT25
PlantName Plant Name TEXT30
StorageLocationName Storage Location Name TEXT16
SupplierName Name of Supplier TEXT80
CustomerName Name of Customer TEXT80
InventoryStockTypeName Stock Type Name DDTEXT
InventorySpecialStockTypeName Description of special stock TEXT20
Master Data Relations Join Conditions
Fiscal Year Variant
  • Client
  • Fiscal Year Variant
  • C_MATERIALSTOCKTIMESERIES.MANDT == T009.MANDT
  • C_MATERIALSTOCKTIMESERIES.FISCALYEARVARIANT == T009.PERIV